PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM05G18240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 489aa    MW: 54259.4 Da    PI: 5.1326
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM05G18240.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.17.2e-4961331128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lppGfrFhPtd elv++yLk+k+ gkk  + ++i++v++yk+ PwdLp + ++++++ ew+fF++rdkky++g+r+nr+t +gyWk++gkd+++
  OGLUM05G18240.1   6 LPPGFRFHPTDVELVSYYLKRKIMGKKPLI-QAISDVELYKFAPWDLPaQsCLQSRDLEWFFFCPRDKKYPNGSRTNRSTPNGYWKTSGKDRTI 98 
                      79*************************777.88**************95347778888************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++ vg kktL+f++g+apkg++tdWvm ey++
  OGLUM05G18240.1  99 EL-NSRIVGSKKTLIFHEGKAPKGNRTDWVMYEYKM 133
                      **.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-573156IPR003441NAC domain
PROSITE profilePS5100555.8226156IPR003441NAC domain
PfamPF023651.4E-257132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MAQTCLPPGF RFHPTDVELV SYYLKRKIMG KKPLIQAISD VELYKFAPWD LPAQSCLQSR  60
DLEWFFFCPR DKKYPNGSRT NRSTPNGYWK TSGKDRTIEL NSRIVGSKKT LIFHEGKAPK  120
GNRTDWVMYE YKMEDNQLVS AGFSKDDFAL CKIFKKSGLG PRIGEQYGAP FNEEEWEHAD  180
AEMFPLLPNV ETSVFPLLPS SEVVNSTDDT RVQPSVAARA IEELPVQHLP HVCAGNGSTY  240
QNITVTGESA LMELPSQHSV ESIGDEVVSV DNCSNVVNNA DSPVIEGLVL EELSRFLTDS  300
PHHGNPVGEH SGLPPMSEAE AHAFEVSTND LYNEIAGLAE LGVPNGDGFS PSNAGVTEQQ  360
PTYFGVPNSE NYHAVPTVIT KSRTVLEDSD TDDLVGFHML AVLRNRCVFM ATCCRSELSQ  420
TSLNLSRGLL LDLLVLELVV TASIVRPTMY IVLKTETVHV FGLKLYKHMG GNCASVRPEI  480
VRPFELNQR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-49215711169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00583DAPTransfer from AT5G64060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3621600.0AB362160.1 Oryza sativa Japonica Group mRNA for transcription factor, complete cds.
GenBankAK0995400.0AK099540.1 Oryza sativa Japonica Group cDNA clone:J013032G17, full insert sequence.
GenBankEU8469980.0EU846998.1 Oryza sativa Japonica Group clone KCS104B01 NAM-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639254.10.0PREDICTED: NAC domain-containing protein 78 isoform X1
TrEMBLA0A0D9ZZF80.0A0A0D9ZZF8_9ORYZ; Uncharacterized protein
STRINGBGIOSGA018023-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os05g35170.10.0(Oryza sativa Japonica Group)
STRINGORGLA05G0148600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47313664
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.15e-79NAC domain containing protein 103